Denmark Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

1,100 results found for denmark

denmark flagdenmark mapswedencopenhagennorwaygreenlandfinlandicelanddenmark peopledenmark nature
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"denmark"
Footage

Danish Flags over Nyhavn district in Copenhagen, Denmark.

Street Traffic in Copenhagen Denmark 5

Boat Harbor in Copenhagen, Denmark 3

Aerial Denmark Copenhagen June 2018 Sunny Day 90mm Zoom 4K Inspire 2 Prores Aerial video of downtown Copenhagen in Denmark on a sunny day with a zoom lens.

Strøget or Stroget pedestrian street, car free shopping area in Copenhagen, Denmark. Tourist attraction in city center with people shopping, shops, stores

Aerial view of Nyhavn at sunrise, with colorful facades of old houses and old ships in the Old Town of Copenhagen, capital of Denmark.

NEW

Aerial view of serene Skelby Kirke surrounded by picturesque fields and tranquil countryside, Skelby, Denmark.

Denmark on a political map - closeup

Aerial view of Kronborg castle with ramparts, ravelin guarding the entrance to the Baltic Sea and the Oresund in Helsingor Denmark

Fly high above metropolis. Aerial panoramic view of large city in flat landscape. Botanical garden, university site and group of lakes. Copenhagen, Denmark

Street Traffic in Copenhagen Denmark 8

Aerial view of the Copenhagen city from above. Denmark. View of the city river, canals and old town.

Scenic timelapse summer sunset view of Nyhavn pier with color buildings, ships, yachts and other boats in the old town of Copenhagen, Denmark

COPENHAGEN, DENMARK - SEPTEMBER 10, 2015: Busy pedestrian street Stroget with lots of stores and cafes. Car free shopping area in the city centre

NEW

Homes And Living In Downtown Aarhus Denmark

COPENHAGEN, DENMARK - SEPTEMBER 10, 2015: Crowded Stroget street. It is one of the longest pedestrian shopping streets in Europe

Danish Flags over Nyhavn district in Copenhagen, Denmark.

Amager Bakke, Amager Hill or Amager Slope or Copenhill - a heat and power waste-to-energy plant and a sports park in Amager, Copenhagen, Denmark. ESG green energy.

Aerial view of famous Nyhavn pier with colorful buildings and boats in Copenhagen, Denmark. The most popular and touristic place in Copenhagen

Aerial Denmark Copenhagen June 2018 Sunny Day 15mm Wide Angle 4K Inspire 2 Prores Aerial video of downtown Copenhagen in Denmark on a sunny day with a wide angle lens.

Aerial view of the Copenhagen in Denmark. Central historical part of the city, city roofs and Copenhagen lakes.

People, tourists, families walking at Tivoli Gardens amusement park in Copenhagen, Denmark during Halloween week

Strøget or Stroget pedestrian street, car free shopping area in Copenhagen, Denmark. Tourist attraction in city center with people shopping, shops, stores

Panoramic aerial close up view of Oresund bridge over the Baltic sea between Malmo city in Sweden and Copenhagen in Denmark.

Street Traffic in Copenhagen Denmark 6

Street Traffic in Copenhagen Denmark 3

Copenhagen, Denmark - October 6, 2018: Copenhagen in the fall, people are walking around the square near the stork fountain, musicians install instruments, someone takes a selfie

NEW

Aarhus Denmark Modern City Skyline

Aerial view of the Copenhagen canal bridges, including drawbridges. Denmark.

Amager Bakke, Amager Hill or Amager Slope or Copenhill - a heat and power waste-to-energy plant and a sports park in Amager, Copenhagen, Denmark. ESG green energy.

Aerial view of Copenhagen, Denmark. Old town and canals in Copenhagen.

Aerial Denmark Copenhagen June 2018 Sunny Day 15mm Wide Angle 4K Inspire 2 Prores Aerial video of downtown Copenhagen in Denmark on a sunny day with a wide angle lens.

Aerial panoramic view of city centre with landmarks and tall towers. Tilt down on vehicles and cyclists passing through crossroad. Copenhagen, Denmark

Aerial view of famous Islands Brygge street. Sliding reveal of swimming area and wide river in city. Copenhagen, Denmark

Urban view of Copenhagen, Denmark. Tourist attraction in city center with balloon showing planet Earth and climate change

Forwards fly around group of tall tower cranes on high rise building construction site. Train driving on railway tracks in city. Copenhagen, Denmark

Danish people, tourists and commuters waiting for subway train arriving at underground metro station in Copenhagen, Denmark, Europe. Railway, transport, transportation, travel

Tivoli Gardens amusement park with people, visitors, tourists, attractions, rides. Urban view of the city of Copenhagen in Denmark, Europe

Boat Harbor in Copenhagen, Denmark

Famous Nyhavn pier with colorful buildings and boats in Copenhagen, Denmark. The most popular and touristic place in Copenhagen

Aerial view of the famous Torvet square in Esbjerg, Denmark with the statue of Christian IX and the Kommune, the Town Hall. Backwards revealing Torvegade, one of Denmark's longest pedestrian streets

Aerial view of Nyhavn at sunrise, with colorful facades of old houses and old ships in the Old Town of Copenhagen, capital of Denmark.

4K Hyperlapse Sequence of Copenhagen, Denmark - The pedestrian streets of Copenhagen during a sunny day

Copenhagen, Denmark - September 10, 2015: The Little Mermaid statue at sunset, a major symbol of the city

Aerial view of the Copenhagen city from above. Denmark. View of the city river, canals and old town.

Aerial Denmark Copenhagen June 2018 Sunny Day 30mm 4K Inspire 2 Prores Aerial video of downtown Copenhagen in Denmark on a sunny day.

Aerial Denmark Copenhagen June 2018 Sunny Day 90mm Zoom 4K Inspire 2 Prores Aerial video of downtown Copenhagen in Denmark on a sunny day with a zoom lens.

Aerial view of Nyhavn at sunrise, with colorful facades of old houses and old ships in the Old Town of Copenhagen, capital of Denmark.