Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,683 results found for hug

lovehug friendshandshakefamilyfriendshappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Couple is hugging. Hands of man and woman. Give more hugs.

Close-up of woman giving a warm hug to a man outdoors

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Family enjoys nature together in a green field with their children, embracing joy and happiness

Portrait of couple hands, sitting on sofa at home in the living room.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Couple wearing masks embrace and hold each other worried - slow motion

Couple embracing after conflict, showing support and forgiveness in living room

A Joyful Evening on the Beach: Couple Embracing

Loving couple sharing affectionate moment while strolling together

mother and daughter laughing and embracing in the summer park on the grass

Happy couple hugging in the city, slow motion, shot at 60fps

Senior couple hugging in the city during sunset, 120fps

Childhood Joy: Little Boy Laughing with Mom at Sunset

Loving couple embracing outdoors

Sunset Silhouette of Couple Embracing at Beach

Couple embracing at home

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

NEW

Sweet friends and sharing a hug after finishing their homework, schoolgirls feeling pleased with their friendship in the library. Cute

Group of Young People Embrace

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Cool Couple Laughing and hugging In Front Of Beach In autumn

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Loving couple sharing affectionate moment while strolling together

NEW

Teenage girl overtaking young parents and they embracing her while walking in winter forest, back view.

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Father hugs his son on the field at sunset. Slowmo

Couple at the meadow

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

Couple Greeting Each Other With Hug As They Meet In Coffee Shop

Side view of Mother and Daughter Sharing a Loving Moment in Living Room

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Reunion of diverse friends in apartment, smiling and talking

A Couple Embraces in a Stunning Sunset

The couple standing against a starry sky with a northern light. time lapse

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

Two mature couples hugging in the park together. Double date of senior couples. Friendly company resting outdoors. Old men and women smiling happily. Slow motion.

Family enjoying autumn walk in the park. Slow motion.